peptides
TB-500 10mg
SKU: GP-TB500-10
Research Grade Peptide
Missing what you're looking for? Drop us a message.
Want 5 or more? Ask us about wholesale rates.
Lab Reports & COA Available on Request
Description
TB-500 10mg – Premium Research Peptide
TB-500, available in a 10mg dosage, is a premium-grade research peptide specifically designed for advanced scientific investigations into cellular regeneration and tissue repair. This product is ideally suited for laboratory environments where accuracy and consistency are critical.
Product Details:
Name: TB-500 10mg
Catalogue Number: GP-TB500-10
Molecular Formula: C212H350N56O78S
Molecular Weight: 4963.4 g/mol
Purity: ≥98%
Amino Acid Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Form: Lyophilised Powder
Usage and Storage:
TB-500 is provided as a lyophilised powder to maximize stability and facilitate ease of use in research settings. For optimal results, please refer to the detailed reconstitution and storage instructions available on our website.
Synthesis and Quality Control:
Our TB-500 peptide is synthesized through a rigorously controlled process to ensure exceptional purity (≥98%) and stability, making it highly suitable for precise scientific applications. Each batch undergoes comprehensive quality assurance testing to meet the stringent standards demanded by researchers.
Legal and Safety Notice:
The Peptide Store supplies TB-500 exclusively for scientific research purposes. We are committed to supporting the research community by providing products that comply with all relevant quality and legal standards. Please be aware that TB-500 and other peptides offered are not intended for human consumption or clinical use.
Please note that our peptides, including TB-500, are not designed for human consumption or clinical application.
